SCOPe 2.06: Domain d3hpfa2: 3hpf A:123-387

Lineage for d3hpfa2 (3hpf A:123-387)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (74 species)
   not a true protein

7. Species Oceanobacillus iheyensis [TaxId:221109] [255838] (3 PDB entries)

8. Domain d3hpfa2: 3hpf A:123-387 [264833]
   Other proteins in same PDB: d3hpfa1, d3hpfb1
   automated match to d2oqya2
   complexed with gae, mg; mutant

Details for d3hpfa2

PDB Entry: 3hpf, 1.8 Å

PDB Description: crystal structure of the mutant y90f of divergent galactarate dehydratase from oceanobacillus iheyensis complexed with mg and galactarate

PDB Compounds: (A:) Muconate cycloisomerase

SCOPe Domain Sequences for d3hpfa2:

Sequence; same for both SEQRES and ATOM records:

>d3hpfa2 c.1.11.0 (A:123-387) automated matches {Oceanobacillus iheyensis [TaxId: 221109]}
rvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvkee
fgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktdyp
isehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqelsv
gtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgieldes
llakyqvpdlswdnvtvhqlqdrta

Timeline for d3hpfa2:

• d3hpfa2 first appeared in SCOPe 2.05
  
• d3hpfa2 appears in SCOPe 2.07
  
• d3hpfa2 appears in the current release, SCOPe 2.08