Lineage for d3hpfa1 (3hpf A:1-122)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904959Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1904960Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1905229Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1905230Protein automated matches [226922] (83 species)
    not a true protein
  7. 1905669Species Oceanobacillus iheyensis [TaxId:221109] [255837] (3 PDB entries)
  8. 1905671Domain d3hpfa1: 3hpf A:1-122 [264832]
    Other proteins in same PDB: d3hpfa2, d3hpfb2
    automated match to d2oqya1
    complexed with gae, mg; mutant

Details for d3hpfa1

PDB Entry: 3hpf (more details), 1.8 Å

PDB Description: crystal structure of the mutant y90f of divergent galactarate dehydratase from oceanobacillus iheyensis complexed with mg and galactarate
PDB Compounds: (A:) Muconate cycloisomerase

SCOPe Domain Sequences for d3hpfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hpfa1 d.54.1.0 (A:1-122) automated matches {Oceanobacillus iheyensis [TaxId: 221109]}
mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
lsillgqnpfdlmkinkeltdnfpetmyyfekgsfirngidnalhdlcakyldisvsdfl
gg

SCOPe Domain Coordinates for d3hpfa1:

Click to download the PDB-style file with coordinates for d3hpfa1.
(The format of our PDB-style files is described here.)

Timeline for d3hpfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hpfa2