Lineage for d1sftb1 (1sft B:2-11,B:245-381)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 61155Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)
  4. 61223Superfamily b.49.2: Alanine racemase-like, C-terminal domain [50621] (1 family) (S)
  5. 61224Family b.49.2.1: Alanine racemase-like, C-terminal domain [50622] (2 proteins)
  6. 61225Protein Alanine racemase [50623] (1 species)
  7. 61226Species Bacillus stearothermophilus [TaxId:1422] [50624] (3 PDB entries)
  8. 61230Domain d1sftb1: 1sft B:2-11,B:245-381 [26483]
    Other proteins in same PDB: d1sfta2, d1sftb2

Details for d1sftb1

PDB Entry: 1sft (more details), 1.9 Å

PDB Description: alanine racemase

SCOP Domain Sequences for d1sftb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sftb1 b.49.2.1 (B:2-11,B:245-381) Alanine racemase {Bacillus stearothermophilus}
ndfhrdtwaeXfslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlq
hfhvlvdgqkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletin
yevpctisyrvpriffrhkrimevrnai

SCOP Domain Coordinates for d1sftb1:

Click to download the PDB-style file with coordinates for d1sftb1.
(The format of our PDB-style files is described here.)

Timeline for d1sftb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sftb2