Lineage for d3hduc_ (3hdu C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944312Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2944313Protein automated matches [190143] (42 species)
    not a true protein
  7. 2944658Species Syntrophus aciditrophicus [TaxId:56780] [267841] (1 PDB entry)
  8. 2944661Domain d3hduc_: 3hdu C: [264829]
    automated match to d3e29d_

Details for d3hduc_

PDB Entry: 3hdu (more details), 2.5 Å

PDB Description: crystal structure of a putative thioesterase (syn_01977) from syntrophus aciditrophicus sb at 2.50 a resolution
PDB Compounds: (C:) Putative thioesterase

SCOPe Domain Sequences for d3hduc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hduc_ d.38.1.0 (C:) automated matches {Syntrophus aciditrophicus [TaxId: 56780]}
kneevlfsavneifeekipfnkiiglkvrfispeqvklsfemrdelignairrmlyggvi
ssaidmtaglaafmgfqekmsgkpmeeklamigrlstmslhveylrpglgrefvctgynv
rtgnkvavirtelmndqdeliavgsvsyilv

SCOPe Domain Coordinates for d3hduc_:

Click to download the PDB-style file with coordinates for d3hduc_.
(The format of our PDB-style files is described here.)

Timeline for d3hduc_: