Lineage for d3h5wb_ (3h5w B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143708Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2143709Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2143710Family c.93.1.1: L-arabinose binding protein-like [53823] (18 protein domains)
  6. 2143811Protein Ionotropic glutamate receptor 2 (GluR2) amino-terminal domain (ATD) [267661] (1 species)
  7. 2143812Species Norway rat (Rattus norvegicus) [TaxId:10116] [267740] (5 PDB entries)
  8. 2143821Domain d3h5wb_: 3h5w B: [264826]
    automated match to d3h5va_

Details for d3h5wb_

PDB Entry: 3h5w (more details), 2.69 Å

PDB Description: Crystal structure of the GluR2-ATD in space group P212121 without solvent
PDB Compounds: (B:) Glutamate receptor 2

SCOPe Domain Sequences for d3h5wb_:

Sequence, based on SEQRES records: (download)

>d3h5wb_ c.93.1.1 (B:) Ionotropic glutamate receptor 2 (GluR2) amino-terminal domain (ATD) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
iqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrgvy
aifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyqwd
kfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkkerr
vildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfgganvsgfqivdyd
dslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrrgn
agdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngprki
gywsevdkmvvt

Sequence, based on observed residues (ATOM records): (download)

>d3h5wb_ c.93.1.1 (B:) Ionotropic glutamate receptor 2 (GluR2) amino-terminal domain (ATD) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
iqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrgvy
aifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyqwd
kfaylydsdrglstlqavldsaaekkwqvtainvgninetyrslfqdlelkkerrvildc
erdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfgganvsgfqivdyddslvs
kfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrgnagdcla
npavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngprkigywsev
dkmvvt

SCOPe Domain Coordinates for d3h5wb_:

Click to download the PDB-style file with coordinates for d3h5wb_.
(The format of our PDB-style files is described here.)

Timeline for d3h5wb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3h5wa_