SCOPe 2.06: Domain d3h5vc_: 3h5v C:

Lineage for d3h5vc_ (3h5v C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)

6. Protein Ionotropic glutamate receptor 2 (GluR2) amino-terminal domain (ATD) [267661] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [267740] (5 PDB entries)

8. Domain d3h5vc_: 3h5v C: [264824]

Details for d3h5vc_

PDB Entry: 3h5v, 2.33 Å

PDB Description: crystal structure of the glur2-atd

PDB Compounds: (C:) Glutamate receptor 2

SCOPe Domain Sequences for d3h5vc_:

Sequence; same for both SEQRES and ATOM records:

>d3h5vc_ c.93.1.1 (C:) Ionotropic glutamate receptor 2 (GluR2) amino-terminal domain (ATD) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
iqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrgvy
aifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyqwd
kfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkkerr
vildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfgganvsgfqivdyd
dslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrrgn
agdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngprki
gywsevdkmvvtl

Timeline for d3h5vc_:

• d3h5vc_ first appeared in SCOPe 2.05
  
• d3h5vc_ appears in SCOPe 2.07
  
• d3h5vc_ appears in the current release, SCOPe 2.08