![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
![]() | Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) ![]() Similar in architecture to the superfamily II but partly differs in topology |
![]() | Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins) |
![]() | Protein Ionotropic glutamate receptor 2 (GluR2) amino-terminal domain (ATD) [267661] (1 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [267740] (5 PDB entries) |
![]() | Domain d3h5vb_: 3h5v B: [264823] |
PDB Entry: 3h5v (more details), 2.33 Å
SCOPe Domain Sequences for d3h5vb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h5vb_ c.93.1.1 (B:) Ionotropic glutamate receptor 2 (GluR2) amino-terminal domain (ATD) {Norway rat (Rattus norvegicus) [TaxId: 10116]} snsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsr gvyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyy qwdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkk errvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfgganvsgfqiv dyddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisr rgnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngp rkigywsevdkmvvtl
Timeline for d3h5vb_: