Lineage for d3h12b1 (3h12 B:4-132)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2947989Species Bordetella bronchiseptica [TaxId:518] [256002] (4 PDB entries)
  8. 2948001Domain d3h12b1: 3h12 B:4-132 [264820]
    Other proteins in same PDB: d3h12a2, d3h12a3, d3h12a4, d3h12b2, d3h12b3, d3h12b4
    automated match to d3ozya1
    complexed with na

Details for d3h12b1

PDB Entry: 3h12 (more details), 1.5 Å

PDB Description: crystal structure of putative mandelate racemase from bordetella bronchiseptica rb50
PDB Compounds: (B:) mandelate racemase

SCOPe Domain Sequences for d3h12b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h12b1 d.54.1.0 (B:4-132) automated matches {Bordetella bronchiseptica [TaxId: 518]}
kitevkahalstpipermrvesgaglklnrqmilvevrtdegvtgvgspsgpydlavlkr
aiedvigpqligedpaninylwhkvfhgevsrnlghrsvgiaamsgvdialwdlkgramn
qpiyqllgg

SCOPe Domain Coordinates for d3h12b1:

Click to download the PDB-style file with coordinates for d3h12b1.
(The format of our PDB-style files is described here.)

Timeline for d3h12b1: