Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (95 species) not a true protein |
Species Bordetella bronchiseptica [TaxId:518] [256002] (4 PDB entries) |
Domain d3h12b1: 3h12 B:4-132 [264820] Other proteins in same PDB: d3h12a2, d3h12a3, d3h12a4, d3h12b2, d3h12b3, d3h12b4 automated match to d3ozya1 complexed with na |
PDB Entry: 3h12 (more details), 1.5 Å
SCOPe Domain Sequences for d3h12b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h12b1 d.54.1.0 (B:4-132) automated matches {Bordetella bronchiseptica [TaxId: 518]} kitevkahalstpipermrvesgaglklnrqmilvevrtdegvtgvgspsgpydlavlkr aiedvigpqligedpaninylwhkvfhgevsrnlghrsvgiaamsgvdialwdlkgramn qpiyqllgg
Timeline for d3h12b1:
View in 3D Domains from other chains: (mouse over for more information) d3h12a1, d3h12a2, d3h12a3, d3h12a4 |