Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (71 species) not a true protein |
Species Bordetella bronchiseptica [TaxId:518] [256003] (4 PDB entries) |
Domain d3h12a2: 3h12 A:133-393 [264819] Other proteins in same PDB: d3h12a1, d3h12b1 automated match to d3ozmh2 complexed with na |
PDB Entry: 3h12 (more details), 1.5 Å
SCOPe Domain Sequences for d3h12a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h12a2 c.1.11.0 (A:133-393) automated matches {Bordetella bronchiseptica [TaxId: 518]} kfhtrgvrayassiywdltpdqaadelagwveqgftaaklkvgraprkdaanlramrqrv gadveilvdanqslgrhdalamlrildeagcywfeeplsiddieghrilraqgtpvriat genlytrnafndyirndaidvlqadasraggitealaisasaasahlawnphtfndiitv aanlhlvaasphpamfewdithndlmtrlasydlklenglvqppqgpglgfeidwdfvaa hawkgepaigaghgmkkeghh
Timeline for d3h12a2: