Lineage for d3guva_ (3guv A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883013Fold c.53: Resolvase-like [53040] (2 superfamilies)
    Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 2883014Superfamily c.53.1: Resolvase-like [53041] (2 families) (S)
    automatically mapped to Pfam PF00239
  5. 2883038Family c.53.1.0: automated matches [227230] (1 protein)
    not a true family
  6. 2883039Protein automated matches [226976] (3 species)
    not a true protein
  7. 2883076Species Streptococcus pneumoniae [TaxId:406562] [267840] (1 PDB entry)
  8. 2883077Domain d3guva_: 3guv A: [264813]
    automated match to d2gm5a_

Details for d3guva_

PDB Entry: 3guv (more details), 2.2 Å

PDB Description: crystal structure of a resolvase family site-specific recombinase from streptococcus pneumoniae
PDB Compounds: (A:) Site-specific recombinase, resolvase family protein

SCOPe Domain Sequences for d3guva_:

Sequence, based on SEQRES records: (download)

>d3guva_ c.53.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 406562]}
kikvylytrvstsiqiegysleaqksrmkafaiyndyeivgeyedagksgksiegriqfn
rmmediksgkdgvsfvlvfklsrfarnaadvlstlqimqdygvnlicvedgidsskdagk
lmisvlsavaeiereniriqtmegciqkare

Sequence, based on observed residues (ATOM records): (download)

>d3guva_ c.53.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 406562]}
kikvylytrvstsiqiegysleaqksrmkafaiyndyeivgeyedagksgksiegriqfn
rmmediksgkdgvsfvlvfklsrfarnaadvlstlqimqdygvnlicvedgidsskdklm
isvlsavaeiereniriqtmegciqkare

SCOPe Domain Coordinates for d3guva_:

Click to download the PDB-style file with coordinates for d3guva_.
(The format of our PDB-style files is described here.)

Timeline for d3guva_: