Lineage for d3gqsb_ (3gqs B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2372848Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2372849Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 2372984Family b.26.1.0: automated matches [191616] (1 protein)
    not a true family
  6. 2372985Protein automated matches [191125] (7 species)
    not a true protein
  7. 2372986Species Chlamydia trachomatis [TaxId:272561] [267838] (1 PDB entry)
  8. 2372988Domain d3gqsb_: 3gqs B: [264810]
    automated match to d4qcja_
    complexed with po4

Details for d3gqsb_

PDB Entry: 3gqs (more details), 2.2 Å

PDB Description: Crystal structure of the FHA domain of CT664 protein from Chlamydia trachomatis
PDB Compounds: (B:) Adenylate cyclase-like protein

SCOPe Domain Sequences for d3gqsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gqsb_ b.26.1.0 (B:) automated matches {Chlamydia trachomatis [TaxId: 272561]}
srfllkvlaganigaefhldsgktyivgsdpqvadivlsdmsisrqhakiiigndnsvli
edlgskngvivegrkiehqstlsanqvvalgttlfllvdya

SCOPe Domain Coordinates for d3gqsb_:

Click to download the PDB-style file with coordinates for d3gqsb_.
(The format of our PDB-style files is described here.)

Timeline for d3gqsb_: