SCOPe 2.07: Domain d1bd0b1: 1bd0 B:2-11,B:245-381

Lineage for d1bd0b1 (1bd0 B:2-11,B:245-381)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
   barrel, closed; n=6, S=8; greek-key
   Many cradle-loop superfamilies may be homologous, according to PubMed 18457946

4. Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families)
   the barrel is decorated with additional structures

5. Family b.49.2.2: Alanine racemase-like, C-terminal domain [88682] (2 proteins)

6. Protein Alanine racemase [50623] (3 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [50624] (8 PDB entries)

8. Domain d1bd0b1: 1bd0 B:2-11,B:245-381 [26481]
   Other proteins in same PDB: d1bd0a2, d1bd0b2
   complexed with in5

Details for d1bd0b1

PDB Entry: 1bd0, 1.6 Å

PDB Description: alanine racemase complexed with alanine phosphonate

PDB Compounds: (B:) alanine racemase

SCOPe Domain Sequences for d1bd0b1:

Sequence; same for both SEQRES and ATOM records:

>d1bd0b1 b.49.2.2 (B:2-11,B:245-381) Alanine racemase {Bacillus stearothermophilus [TaxId: 1422]}
ndfhrdtwaeXfslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlq
hfhvlvdgqkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletin
yevpctisyrvpriffrhkrimevrnai

Timeline for d1bd0b1:

• d1bd0b1 first appeared (with stable ids) in SCOP 1.55
  
• d1bd0b1 appears in SCOPe 2.06
  
• d1bd0b1 appears in the current release, SCOPe 2.08