Class b: All beta proteins [48724] (176 folds) |
Fold b.26: SMAD/FHA domain [49878] (1 superfamily) sandwich; 11 strands in 2 sheets; greek-key |
Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) has a few short helices inserted in loops |
Family b.26.1.0: automated matches [191616] (1 protein) not a true family |
Protein automated matches [191125] (7 species) not a true protein |
Species Chlamydia trachomatis [TaxId:272561] [267838] (1 PDB entry) |
Domain d3gqsa_: 3gqs A: [264809] automated match to d4qcja_ complexed with po4 |
PDB Entry: 3gqs (more details), 2.2 Å
SCOPe Domain Sequences for d3gqsa_:
Sequence, based on SEQRES records: (download)
>d3gqsa_ b.26.1.0 (A:) automated matches {Chlamydia trachomatis [TaxId: 272561]} srfllkvlaganigaefhldsgktyivgsdpqvadivlsdmsisrqhakiiigndnsvli edlgskngvivegrkiehqstlsanqvvalgttlfllvdya
>d3gqsa_ b.26.1.0 (A:) automated matches {Chlamydia trachomatis [TaxId: 272561]} srfllkvlaanigaefhldsgktyivgsdpqvadivlsdmsisrqhakiiigndnsvlie dlgskngvivegrkiehqstlsanqvvalgttlfllvdya
Timeline for d3gqsa_: