SCOPe 2.05: Domain d3gqsa_: 3gqs A:

Lineage for d3gqsa_ (3gqs A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
   sandwich; 11 strands in 2 sheets; greek-key

4. Superfamily b.26.1: SMAD/FHA domain [49879] (5 families)
   has a few short helices inserted in loops

5. Family b.26.1.0: automated matches [191616] (1 protein)
   not a true family

6. Protein automated matches [191125] (7 species)
   not a true protein

7. Species Chlamydia trachomatis [TaxId:272561] [267838] (1 PDB entry)

8. Domain d3gqsa_: 3gqs A: [264809]
   automated match to d4qcja_
   complexed with po4

Details for d3gqsa_

PDB Entry: 3gqs, 2.2 Å

PDB Description: crystal structure of the fha domain of ct664 protein from chlamydia trachomatis

PDB Compounds: (A:) Adenylate cyclase-like protein

SCOPe Domain Sequences for d3gqsa_:

Sequence, based on SEQRES records:

>d3gqsa_ b.26.1.0 (A:) automated matches {Chlamydia trachomatis [TaxId: 272561]}
srfllkvlaganigaefhldsgktyivgsdpqvadivlsdmsisrqhakiiigndnsvli
edlgskngvivegrkiehqstlsanqvvalgttlfllvdya

Sequence, based on observed residues (ATOM records):

>d3gqsa_ b.26.1.0 (A:) automated matches {Chlamydia trachomatis [TaxId: 272561]}
srfllkvlaanigaefhldsgktyivgsdpqvadivlsdmsisrqhakiiigndnsvlie
dlgskngvivegrkiehqstlsanqvvalgttlfllvdya

Timeline for d3gqsa_:

• d3gqsa_ is new in SCOPe 2.05-stable
  
• d3gqsa_ appears in SCOPe 2.06
  
• d3gqsa_ appears in the current release, SCOPe 2.08