Lineage for d3gqsa_ (3gqs A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778062Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2778063Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 2778206Family b.26.1.0: automated matches [191616] (1 protein)
    not a true family
  6. 2778207Protein automated matches [191125] (8 species)
    not a true protein
  7. 2778215Species Chlamydia trachomatis [TaxId:272561] [267838] (1 PDB entry)
  8. 2778216Domain d3gqsa_: 3gqs A: [264809]
    automated match to d4qcja_
    complexed with po4

Details for d3gqsa_

PDB Entry: 3gqs (more details), 2.2 Å

PDB Description: crystal structure of the fha domain of ct664 protein from chlamydia trachomatis
PDB Compounds: (A:) Adenylate cyclase-like protein

SCOPe Domain Sequences for d3gqsa_:

Sequence, based on SEQRES records: (download)

>d3gqsa_ b.26.1.0 (A:) automated matches {Chlamydia trachomatis [TaxId: 272561]}
srfllkvlaganigaefhldsgktyivgsdpqvadivlsdmsisrqhakiiigndnsvli
edlgskngvivegrkiehqstlsanqvvalgttlfllvdya

Sequence, based on observed residues (ATOM records): (download)

>d3gqsa_ b.26.1.0 (A:) automated matches {Chlamydia trachomatis [TaxId: 272561]}
srfllkvlaanigaefhldsgktyivgsdpqvadivlsdmsisrqhakiiigndnsvlie
dlgskngvivegrkiehqstlsanqvvalgttlfllvdya

SCOPe Domain Coordinates for d3gqsa_:

Click to download the PDB-style file with coordinates for d3gqsa_.
(The format of our PDB-style files is described here.)

Timeline for d3gqsa_: