Lineage for d3fxba_ (3fxb A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2916130Species Silicibacter pomeroyi [TaxId:246200] [267836] (1 PDB entry)
  8. 2916131Domain d3fxba_: 3fxb A: [264803]
    automated match to d3gyyb_
    complexed with 4cs

Details for d3fxba_

PDB Entry: 3fxb (more details), 2.9 Å

PDB Description: Crystal structure of the ectoine-binding protein UehA
PDB Compounds: (A:) TRAP dicarboxylate transporter, DctP subunit

SCOPe Domain Sequences for d3fxba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fxba_ c.94.1.0 (A:) automated matches {Silicibacter pomeroyi [TaxId: 246200]}
dtwryafeeamtdvqgvyaqkfkeeieansdheiqlfpygtlgesadimeqtqdgilqfv
dqspgftgslipeaqvffvpyllptdqdhlarffkeskaindmfkplyadqglellnmfp
egevamttktpvttcsdldevkfrvmtnpllvesykafgatptplpwgevygglqtnviq
gqenptfflystkiyevtdyityaghnnfttavmankdfydglsaedqqlvqnaalaayd
htvvyqqqaadtelakimeakpemqvtvltdeqrscfkeaaaeveakfiemtgdsgaail
kqmkadlaat

SCOPe Domain Coordinates for d3fxba_:

Click to download the PDB-style file with coordinates for d3fxba_.
(The format of our PDB-style files is described here.)

Timeline for d3fxba_: