SCOP 1.61: Domain d1bd0a1: 1bd0 A:2-11,A:245-382

Lineage for d1bd0a1 (1bd0 A:2-11,A:245-382)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)

4. Superfamily b.49.2: Alanine racemase-like, C-terminal domain [50621] (1 family)

5. Family b.49.2.1: Alanine racemase-like, C-terminal domain [50622] (2 proteins)

6. Protein Alanine racemase [50623] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [50624] (5 PDB entries)

8. Domain d1bd0a1: 1bd0 A:2-11,A:245-382 [26480]
   Other proteins in same PDB: d1bd0a2, d1bd0b2

Details for d1bd0a1

PDB Entry: 1bd0, 1.6 Å

PDB Description: alanine racemase complexed with alanine phosphonate

SCOP Domain Sequences for d1bd0a1:

Sequence; same for both SEQRES and ATOM records:

>d1bd0a1 b.49.2.1 (A:2-11,A:245-382) Alanine racemase {Bacillus stearothermophilus}
ndfhrdtwaeXfslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlq
hfhvlvdgqkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletin
yevpctisyrvpriffrhkrimevrnaig

Timeline for d1bd0a1:

• d1bd0a1 first appeared (with stable ids) in SCOP 1.55
  
• d1bd0a1 appears in SCOP 1.59
  
• d1bd0a1 appears in SCOP 1.63
  
• d1bd0a1 appears in the current release, SCOPe 2.08