Lineage for d1bd0a1 (1bd0 A:2-11,A:245-382)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 168781Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)
  4. 168851Superfamily b.49.2: Alanine racemase-like, C-terminal domain [50621] (1 family) (S)
  5. 168852Family b.49.2.1: Alanine racemase-like, C-terminal domain [50622] (2 proteins)
  6. 168853Protein Alanine racemase [50623] (1 species)
  7. 168854Species Bacillus stearothermophilus [TaxId:1422] [50624] (5 PDB entries)
  8. 168855Domain d1bd0a1: 1bd0 A:2-11,A:245-382 [26480]
    Other proteins in same PDB: d1bd0a2, d1bd0b2

Details for d1bd0a1

PDB Entry: 1bd0 (more details), 1.6 Å

PDB Description: alanine racemase complexed with alanine phosphonate

SCOP Domain Sequences for d1bd0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bd0a1 b.49.2.1 (A:2-11,A:245-382) Alanine racemase {Bacillus stearothermophilus}
ndfhrdtwaeXfslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlq
hfhvlvdgqkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletin
yevpctisyrvpriffrhkrimevrnaig

SCOP Domain Coordinates for d1bd0a1:

Click to download the PDB-style file with coordinates for d1bd0a1.
(The format of our PDB-style files is described here.)

Timeline for d1bd0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bd0a2