Lineage for d3frxb_ (3frx B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2065971Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2066122Family b.69.4.0: automated matches [191412] (1 protein)
    not a true family
  6. 2066123Protein automated matches [190568] (6 species)
    not a true protein
  7. 2066124Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [267834] (2 PDB entries)
  8. 2066126Domain d3frxb_: 3frx B: [264798]
    automated match to d4aowa_
    complexed with mn

Details for d3frxb_

PDB Entry: 3frx (more details), 2.13 Å

PDB Description: Crystal Structure of the Yeast Orthologue of RACK1, Asc1.
PDB Compounds: (B:) Guanine nucleotide-binding protein subunit beta-like protein

SCOPe Domain Sequences for d3frxb_:

Sequence, based on SEQRES records: (download)

>d3frxb_ b.69.4.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
masnevlvlrgtleghngwvtslatsagqpnlllsasrdktliswkltgddqkfgvpvrs
fkghshivqdctltadgayalsaswdktlrlwdvatgetyqrfvghksdvmsvdidkkas
miisgsrdktikvwtikgqclatllghndwvsqvrvvpnekadddsvtiisagndkmvka
wnlnqfqieadfighnsnintltaspdgtliasagkdgeimlwnlaakkamytlsaqdev
fslafspnrywlaaatatgikvfsldpqylvddlrpefagyskaaephavslawsadgqt
lfagytdnvirvwqvmtan

Sequence, based on observed residues (ATOM records): (download)

>d3frxb_ b.69.4.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
masnevlvlrgtleghngwvtslatsagqpnlllsasrdktliswkltgddqkfgvpvrs
fkghshivqdctltadgayalsaswdktlrlwdvatgetyqrfvghksdvmsvdidkkas
miisgsrdktikvwtikgqclatllghndwvsqvrvvpnsvtiisagndkmvkawnlnqf
qieadfighnsnintltaspdgtliasagkdgeimlwnlaakkamytlsaqdevfslafs
pnrywlaaatatgikvfsldpqylvddlrpefagyskaaephavslawsadgqtlfagyt
dnvirvwqvmtan

SCOPe Domain Coordinates for d3frxb_:

Click to download the PDB-style file with coordinates for d3frxb_.
(The format of our PDB-style files is described here.)

Timeline for d3frxb_: