SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3fmgl2 (3fmg L:108-211)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (12 species)
    not a true protein
  7. 2025381Species Mouse (Mus musculus) [TaxId:10090] [224855] (451 PDB entries)
  8. 2025971Domain d3fmgl2: 3fmg L:108-211 [264795]
    Other proteins in same PDB: d3fmgl1
    automated match to d4m43l2
    complexed with ca

Details for d3fmgl2

PDB Entry: 3fmg (more details), 3.4 Å

PDB Description: Structure of rotavirus outer capsid protein VP7 trimer in complex with a neutralizing Fab
PDB Compounds: (L:) Fab of neutralizing antibody 4F8, light chain

SCOPe Domain Sequences for d3fmgl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fmgl2 b.1.1.2 (L:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsskqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d3fmgl2:

Click to download the PDB-style file with coordinates for d3fmgl2.
(The format of our PDB-style files is described here.)

Timeline for d3fmgl2: