Lineage for d3fdha_ (3fdh A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007336Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 2007586Family a.118.8.0: automated matches [191581] (1 protein)
    not a true family
  6. 2007587Protein automated matches [191037] (12 species)
    not a true protein
  7. 2007596Species Bacteroides thetaiotaomicron [TaxId:226186] [228123] (2 PDB entries)
  8. 2007597Domain d3fdha_: 3fdh A: [264790]
    automated match to d4puca_
    complexed with pg4

Details for d3fdha_

PDB Entry: 3fdh (more details), 1.75 Å

PDB Description: crystal structure of a susd/ragb family protein (bt_2033) from bacteroides thetaiotaomicron vpi-5482 at 1.75 a resolution
PDB Compounds: (A:) SusD homolog

SCOPe Domain Sequences for d3fdha_:

Sequence, based on SEQRES records: (download)

>d3fdha_ a.118.8.0 (A:) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
svasrfiladvitstafsnasgdintyassyieyevgvdnqlyyaevrenepsssstfnn
swngiysslknariiidqcgeggrdhgndvtrgmaevmaayncaliadffgdapcsqaal
vdekgspvymtpkmdtqqeiytqiisylddaianlqkedladvteqdflyagdadkwlkf
ayglkarytmrlinrssnksadyekvldyvsksftsaddqaafdiydsnninpfygfyns
ragfgastslgtkllayndpranrafftpivdkkrsqvaandpslvpapngspdqstsky
gisafvyaktaptllmsyhelmflkaealcrlnrdaedalkeavvagllnaensisiaik
elgsglntnssevitetsagkyfddvvkakyaanplqetmiqkylamwgasgeatetynd
frrmkglnenfitltnpnnsskfplrypygnsdtaanpevkaaygngdyvysepvwwagg
sr

Sequence, based on observed residues (ATOM records): (download)

>d3fdha_ a.118.8.0 (A:) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
svasrfiladvitstafsnasgdintyassyieyevgvdnqlyyaevrenepsssstfnn
swngiysslknariiidqcgeggrdhgndvtrgmaevmaayncaliadffgdapcsqaam
tpkmdtqqeiytqiisylddaianlqkedladvteqdflyagdadkwlkfayglkarytm
rlinrssnksadyekvldyvsksftsaddqaafdiydsnninpfygfynsragfgastsl
gtkllayndpranrafftpivdkkrsqvaandpslvpapngspdqstskygisafvyakt
aptllmsyhelmflkaealcrlnrdaedalkeavvagllnaensisiaikelgsglntns
sevitetsagkyfddvvkakyaanplqetmiqkylamwgasgeatetyndfrrmkglnen
fitltnpnnsskfplrypygnsdtaanpevkaaygngdyvysepvwwaggsr

SCOPe Domain Coordinates for d3fdha_:

Click to download the PDB-style file with coordinates for d3fdha_.
(The format of our PDB-style files is described here.)

Timeline for d3fdha_: