Lineage for d1skye2 (1sky E:1-82)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 562760Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 562761Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
  5. 562762Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 562808Protein F1 ATP synthase beta subunit, domain 1 [88677] (4 species)
  7. 562809Species Bacillus sp., strain ps3 [TaxId:1409] [88680] (1 PDB entry)
  8. 562810Domain d1skye2: 1sky E:1-82 [26479]
    Other proteins in same PDB: d1skyb1, d1skyb2, d1skyb3, d1skye1, d1skye3
    complexed with so4

Details for d1skye2

PDB Entry: 1sky (more details), 3.2 Å

PDB Description: crystal structure of the nucleotide free alpha3beta3 sub-complex of f1-atpase from the thermophilic bacillus ps3

SCOP Domain Sequences for d1skye2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1skye2 b.49.1.1 (E:1-82) F1 ATP synthase beta subunit, domain 1 {Bacillus sp., strain ps3}
mtrgrviqvmgpvvdvkfenghlpaiynalkiqhkarnenevdidltlevalhlgddtvr
tiamastdglirgmevidtgap

SCOP Domain Coordinates for d1skye2:

Click to download the PDB-style file with coordinates for d1skye2.
(The format of our PDB-style files is described here.)

Timeline for d1skye2: