| Class b: All beta proteins [48724] (149 folds) |
| Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) ![]() |
| Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins) 6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?) |
| Protein F1 ATP synthase beta subunit, domain 1 [88677] (4 species) |
| Species Bacillus sp., strain ps3 [TaxId:1409] [88680] (1 PDB entry) |
| Domain d1skye2: 1sky E:1-82 [26479] Other proteins in same PDB: d1skyb1, d1skyb2, d1skyb3, d1skye1, d1skye3 complexed with so4 |
PDB Entry: 1sky (more details), 3.2 Å
SCOP Domain Sequences for d1skye2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1skye2 b.49.1.1 (E:1-82) F1 ATP synthase beta subunit, domain 1 {Bacillus sp., strain ps3}
mtrgrviqvmgpvvdvkfenghlpaiynalkiqhkarnenevdidltlevalhlgddtvr
tiamastdglirgmevidtgap
Timeline for d1skye2: