SCOP 1.61: Domain d1skye2: 1sky E:1-82

Lineage for d1skye2 (1sky E:1-82)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)

4. Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family)

5. Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (1 protein)

6. Protein N-terminal domain of alpha and beta subunits of F1 ATP synthase [50617] (4 species)

7. Species Bacillus sp., strain ps3 [TaxId:1409] [50620] (1 PDB entry)

8. Domain d1skye2: 1sky E:1-82 [26479]
   Other proteins in same PDB: d1skyb1, d1skyb3, d1skye1, d1skye3

Details for d1skye2

PDB Entry: 1sky

PDB Description: crystal structure of the nucleotide free alpha3beta3 sub-complex of f1-atpase from the thermophilic bacillus ps3

SCOP Domain Sequences for d1skye2:

Sequence; same for both SEQRES and ATOM records:

>d1skye2 b.49.1.1 (E:1-82) N-terminal domain of alpha and beta subunits of F1 ATP synthase {Bacillus sp., strain ps3}
mtrgrviqvmgpvvdvkfenghlpaiynalkiqhkarnenevdidltlevalhlgddtvr
tiamastdglirgmevidtgap

Timeline for d1skye2:

• d1skye2 first appeared (with stable ids) in SCOP 1.55
  
• d1skye2 appears in SCOP 1.59
  
• d1skye2 appears in SCOP 1.63
  
• d1skye2 appears in the current release, SCOPe 2.08