Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.95: Homing endonuclease-like [55603] (2 superfamilies) alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243 |
Superfamily d.95.2: Homing endonucleases [55608] (3 families) |
Family d.95.2.1: Group I mobile intron endonuclease [55609] (6 proteins) contains two extra helices in the C-terminal extension |
Protein automated matches [190411] (4 species) not a true protein |
Species Monomastix sp. [TaxId:141716] [267832] (1 PDB entry) |
Domain d3fd2a1: 3fd2 A:5-178 [264788] automated match to d1m5xa_ protein/DNA complex; complexed with ca |
PDB Entry: 3fd2 (more details), 2.69 Å
SCOPe Domain Sequences for d3fd2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fd2a1 d.95.2.1 (A:5-178) automated matches {Monomastix sp. [TaxId: 141716]} ntlqpteaayiagfldgdgsiyakliprpdykdikyqvslaisfiqrkdkfpylqdiydq lgkrgnlrkdrgdgiadytiigsthlsiilpdlvpylrikkkqanrilhiinlypqaqkn pskfldlvkivddvqnlnkradelkstnydrlleeflkagkiessptgsgsgsk
Timeline for d3fd2a1: