SCOPe 2.08: Domain d3fd2a1: 3fd2 A:5-178

Lineage for d3fd2a1 (3fd2 A:5-178)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
   alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243

4. Superfamily d.95.2: Homing endonucleases [55608] (3 families)

5. Family d.95.2.1: Group I mobile intron endonuclease [55609] (6 proteins)
   contains two extra helices in the C-terminal extension

6. Protein automated matches [190411] (4 species)
   not a true protein

7. Species Monomastix sp. [TaxId:141716] [267832] (1 PDB entry)

8. Domain d3fd2a1: 3fd2 A:5-178 [264788]
   automated match to d1m5xa_
   protein/DNA complex; complexed with ca

Details for d3fd2a1

PDB Entry: 3fd2, 2.69 Å

PDB Description: crystal structure of mmsoi/dna complex with calcium

PDB Compounds: (A:) Site-specific DNA endonuclease I-MsoI

SCOPe Domain Sequences for d3fd2a1:

Sequence; same for both SEQRES and ATOM records:

>d3fd2a1 d.95.2.1 (A:5-178) automated matches {Monomastix sp. [TaxId: 141716]}
ntlqpteaayiagfldgdgsiyakliprpdykdikyqvslaisfiqrkdkfpylqdiydq
lgkrgnlrkdrgdgiadytiigsthlsiilpdlvpylrikkkqanrilhiinlypqaqkn
pskfldlvkivddvqnlnkradelkstnydrlleeflkagkiessptgsgsgsk

Timeline for d3fd2a1:

• d3fd2a1 first appeared in SCOPe 2.05
  
• d3fd2a1 appears in SCOPe 2.07