Lineage for d3es8g2 (3es8 G:123-387)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2422501Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2422949Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2422950Protein automated matches [226923] (74 species)
    not a true protein
  7. 2423328Species Oceanobacillus iheyensis [TaxId:182710] [255531] (3 PDB entries)
  8. 2423345Domain d3es8g2: 3es8 G:123-387 [264783]
    Other proteins in same PDB: d3es8a1, d3es8b1, d3es8c1, d3es8d1, d3es8e1, d3es8f1, d3es8g1, d3es8h1
    automated match to d2oqya2
    complexed with lmr, mg

Details for d3es8g2

PDB Entry: 3es8 (more details), 2.2 Å

PDB Description: crystal structure of divergent enolase from oceanobacillus iheyensis complexed with mg and l-malate.
PDB Compounds: (G:) Muconate cycloisomerase

SCOPe Domain Sequences for d3es8g2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3es8g2 c.1.11.0 (G:123-387) automated matches {Oceanobacillus iheyensis [TaxId: 182710]}
rvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvkee
fgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktdyp
isehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqelsv
gtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgieldes
llakyqvpdlswdnvtvhqlqdrta

SCOPe Domain Coordinates for d3es8g2:

Click to download the PDB-style file with coordinates for d3es8g2.
(The format of our PDB-style files is described here.)

Timeline for d3es8g2: