Lineage for d1skyb2 (1sky B:21-95)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1795771Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 1795772Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (2 families) (S)
    automatically mapped to Pfam PF02874
  5. 1795773Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 1795774Protein F1 ATP synthase alpha subunit, domain 1 [88672] (4 species)
  7. 1795775Species Bacillus sp., strain ps3 [TaxId:1409] [88675] (1 PDB entry)
  8. 1795776Domain d1skyb2: 1sky B:21-95 [26478]
    Other proteins in same PDB: d1skyb1, d1skyb3, d1skye1, d1skye2, d1skye3
    complexed with so4

Details for d1skyb2

PDB Entry: 1sky (more details), 3.2 Å

PDB Description: crystal structure of the nucleotide free alpha3beta3 sub-complex of f1-atpase from the thermophilic bacillus ps3
PDB Compounds: (B:) f1-ATPase

SCOPe Domain Sequences for d1skyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1skyb2 b.49.1.1 (B:21-95) F1 ATP synthase alpha subunit, domain 1 {Bacillus sp., strain ps3 [TaxId: 1409]}
sqiqvsdvgtviqvgdgiarahgldnvmsgeavefanavmgmalnleennvgivilgpyt
gikegdevrrtgrim

SCOPe Domain Coordinates for d1skyb2:

Click to download the PDB-style file with coordinates for d1skyb2.
(The format of our PDB-style files is described here.)

Timeline for d1skyb2: