Lineage for d3es8e1 (3es8 E:1-122)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2515158Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2515159Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2515455Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2515456Protein automated matches [226922] (88 species)
    not a true protein
  7. 2515920Species Oceanobacillus iheyensis [TaxId:182710] [255530] (3 PDB entries)
  8. 2515935Domain d3es8e1: 3es8 E:1-122 [264778]
    Other proteins in same PDB: d3es8a2, d3es8b2, d3es8c2, d3es8d2, d3es8e2, d3es8f2, d3es8g2, d3es8h2
    automated match to d2oqya1
    complexed with lmr, mg

Details for d3es8e1

PDB Entry: 3es8 (more details), 2.2 Å

PDB Description: crystal structure of divergent enolase from oceanobacillus iheyensis complexed with mg and l-malate.
PDB Compounds: (E:) Muconate cycloisomerase

SCOPe Domain Sequences for d3es8e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3es8e1 d.54.1.0 (E:1-122) automated matches {Oceanobacillus iheyensis [TaxId: 182710]}
mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
lsillgqnpfdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdfl
gg

SCOPe Domain Coordinates for d3es8e1:

Click to download the PDB-style file with coordinates for d3es8e1.
(The format of our PDB-style files is described here.)

Timeline for d3es8e1: