Lineage for d3es7b1 (3es7 B:1-122)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948388Species Oceanobacillus iheyensis [TaxId:182710] [255530] (3 PDB entries)
  8. 2948390Domain d3es7b1: 3es7 B:1-122 [264768]
    Other proteins in same PDB: d3es7a2, d3es7b2
    automated match to d2oqya1
    complexed with lmr, mg

Details for d3es7b1

PDB Entry: 3es7 (more details), 1.9 Å

PDB Description: crystal structure of divergent enolase from oceanobacillus iheyensis complexed with mg and l-malate.
PDB Compounds: (B:) Muconate cycloisomerase

SCOPe Domain Sequences for d3es7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3es7b1 d.54.1.0 (B:1-122) automated matches {Oceanobacillus iheyensis [TaxId: 182710]}
mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
lsillgqnpfdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdfl
gg

SCOPe Domain Coordinates for d3es7b1:

Click to download the PDB-style file with coordinates for d3es7b1.
(The format of our PDB-style files is described here.)

Timeline for d3es7b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3es7b2