Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (83 species) not a true protein |
Species Oceanobacillus iheyensis [TaxId:182710] [255530] (3 PDB entries) |
Domain d3es7a1: 3es7 A:1-122 [264766] Other proteins in same PDB: d3es7a2, d3es7b2 automated match to d2oqya1 complexed with lmr, mg |
PDB Entry: 3es7 (more details), 1.9 Å
SCOPe Domain Sequences for d3es7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3es7a1 d.54.1.0 (A:1-122) automated matches {Oceanobacillus iheyensis [TaxId: 182710]} mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl lsillgqnpfdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdfl gg
Timeline for d3es7a1: