| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily) mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix |
Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) ![]() duplication: consists of two similar domain swapped with C-terminal strands |
| Family d.21.1.1: Diaminopimelate epimerase [54507] (1 protein) automatically mapped to Pfam PF01678 |
| Protein Diaminopimelate epimerase [54508] (3 species) |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [267831] (2 PDB entries) |
| Domain d3ekme2: 3ekm E:159-311 [264764] automated match to d4ijza2 complexed with zdr |
PDB Entry: 3ekm (more details), 2.3 Å
SCOPe Domain Sequences for d3ekme2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ekme2 d.21.1.1 (E:159-311) Diaminopimelate epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lsgnkgeavveaelvvdgvswnvtcvsmgnphcitfgkkggpnlkvddlnlpeigpkfeh
hemfpartntefvevlsrshlkmrvwergagatlacgtgacalvvaavlegradrkctvd
lpggpleiewkqednhiymtgpaeavfygsall
Timeline for d3ekme2: