SCOPe 2.08: Domain d3ekme1: 3ekm E:25-158

Lineage for d3ekme1 (3ekm E:25-158)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.1: Diaminopimelate epimerase [54507] (2 proteins)
   automatically mapped to Pfam PF01678

6. Protein Diaminopimelate epimerase [54508] (3 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [267831] (2 PDB entries)

8. Domain d3ekme1: 3ekm E:25-158 [264763]
   automated match to d4ijza1
   complexed with zdr

Details for d3ekme1

PDB Entry: 3ekm, 2.3 Å

PDB Description: Crystal structure of diaminopimelate epimerase form arabidopsis thaliana in complex with irreversible inhibitor DL-AziDAP

PDB Compounds: (E:) Diaminopimelate epimerase, chloroplastic

SCOPe Domain Sequences for d3ekme1:

Sequence; same for both SEQRES and ATOM records:

>d3ekme1 d.21.1.1 (E:25-158) Diaminopimelate epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gvlhfvkyhglgndfilvdnrdssepkitqeqaaklcdrnfgvgadgvifampgvngtdy
amrifnsdgsepemcgngvrcfarfiaelenlqgkhsftihtgaglivpeiqddgqvkvd
mgtpilkaqdvptk

Timeline for d3ekme1:

• d3ekme1 first appeared in SCOPe 2.05
  
• d3ekme1 appears in SCOPe 2.07