Lineage for d1maba2 (1mab A:10-94)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 112456Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)
  4. 112457Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
  5. 112458Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (1 protein)
  6. 112459Protein N-terminal domain of alpha and beta subunits of F1 ATP synthase [50617] (4 species)
  7. 112518Species Rat (Rattus norvegicus) [TaxId:10116] [50619] (1 PDB entry)
  8. 112519Domain d1maba2: 1mab A:10-94 [26476]
    Other proteins in same PDB: d1maba1, d1maba3, d1mabb1, d1mabb3, d1mabg_

Details for d1maba2

PDB Entry: 1mab (more details), 2.8 Å

PDB Description: rat liver f1-atpase

SCOP Domain Sequences for d1maba2:

Sequence, based on SEQRES records: (download)

>d1maba2 b.49.1.1 (A:10-94) N-terminal domain of alpha and beta subunits of F1 ATP synthase {Rat (Rattus norvegicus)}
ssileerilgadtsvdleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlep
dnvgvvvfgndklikegdivkrtgai

Sequence, based on observed residues (ATOM records): (download)

>d1maba2 b.49.1.1 (A:10-94) N-terminal domain of alpha and beta subunits of F1 ATP synthase {Rat (Rattus norvegicus)}
ssileerigadtsvdleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepd
nvgvvvfgndklikegdivkrtgai

SCOP Domain Coordinates for d1maba2:

Click to download the PDB-style file with coordinates for d1maba2.
(The format of our PDB-style files is described here.)

Timeline for d1maba2: