![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
![]() | Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) ![]() automatically mapped to Pfam PF02874 |
![]() | Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (3 proteins) 6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?) |
![]() | Protein F1 ATP synthase alpha subunit, domain 1 [88672] (5 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [88674] (1 PDB entry) |
![]() | Domain d1maba2: 1mab A:10-94 [26476] Other proteins in same PDB: d1maba1, d1maba3, d1mabb1, d1mabb2, d1mabb3, d1mabg_ complexed with adp, atp, mg, po4 |
PDB Entry: 1mab (more details), 2.8 Å
SCOPe Domain Sequences for d1maba2:
Sequence, based on SEQRES records: (download)
>d1maba2 b.49.1.1 (A:10-94) F1 ATP synthase alpha subunit, domain 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]} ssileerilgadtsvdleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlep dnvgvvvfgndklikegdivkrtgai
>d1maba2 b.49.1.1 (A:10-94) F1 ATP synthase alpha subunit, domain 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]} ssileerigadtsvdleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepd nvgvvvfgndklikegdivkrtgai
Timeline for d1maba2:
![]() Domains from other chains: (mouse over for more information) d1mabb1, d1mabb2, d1mabb3, d1mabg_ |