Lineage for d3ejxc2 (3ejx C:159-311)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939535Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 2939536Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 2939537Family d.21.1.1: Diaminopimelate epimerase [54507] (2 proteins)
    automatically mapped to Pfam PF01678
  6. 2939538Protein Diaminopimelate epimerase [54508] (3 species)
  7. 2939561Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [267831] (2 PDB entries)
  8. 2939567Domain d3ejxc2: 3ejx C:159-311 [264754]
    Other proteins in same PDB: d3ejxb3
    automated match to d4ijza2
    complexed with zdp

Details for d3ejxc2

PDB Entry: 3ejx (more details), 1.95 Å

PDB Description: Crystal structure of diaminopimelate epimerase from Arabidopsis thaliana in complex with LL-AziDAP
PDB Compounds: (C:) Diaminopimelate epimerase, chloroplastic

SCOPe Domain Sequences for d3ejxc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ejxc2 d.21.1.1 (C:159-311) Diaminopimelate epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lsgnkgeavveaelvvdgvswnvtcvsmgnphcitfgkkggpnlkvddlnlpeigpkfeh
hemfpartntefvevlsrshlkmrvwergagatlacgtgacalvvaavlegradrkctvd
lpggpleiewkqednhiymtgpaeavfygsall

SCOPe Domain Coordinates for d3ejxc2:

Click to download the PDB-style file with coordinates for d3ejxc2.
(The format of our PDB-style files is described here.)

Timeline for d3ejxc2: