| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily) mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix |
Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) ![]() duplication: consists of two similar domain swapped with C-terminal strands |
| Family d.21.1.1: Diaminopimelate epimerase [54507] (2 proteins) automatically mapped to Pfam PF01678 |
| Protein Diaminopimelate epimerase [54508] (3 species) |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [267831] (2 PDB entries) |
| Domain d3ejxc2: 3ejx C:159-311 [264754] Other proteins in same PDB: d3ejxb3 automated match to d4ijza2 complexed with zdp |
PDB Entry: 3ejx (more details), 1.95 Å
SCOPe Domain Sequences for d3ejxc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ejxc2 d.21.1.1 (C:159-311) Diaminopimelate epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lsgnkgeavveaelvvdgvswnvtcvsmgnphcitfgkkggpnlkvddlnlpeigpkfeh
hemfpartntefvevlsrshlkmrvwergagatlacgtgacalvvaavlegradrkctvd
lpggpleiewkqednhiymtgpaeavfygsall
Timeline for d3ejxc2: