Lineage for d3ejxc1 (3ejx C:25-158)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898719Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 1898720Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 1898721Family d.21.1.1: Diaminopimelate epimerase [54507] (1 protein)
    automatically mapped to Pfam PF01678
  6. 1898722Protein Diaminopimelate epimerase [54508] (3 species)
  7. 1898745Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [267831] (2 PDB entries)
  8. 1898750Domain d3ejxc1: 3ejx C:25-158 [264753]
    automated match to d4ijza1
    complexed with zdp

Details for d3ejxc1

PDB Entry: 3ejx (more details), 1.95 Å

PDB Description: Crystal structure of diaminopimelate epimerase from Arabidopsis thaliana in complex with LL-AziDAP
PDB Compounds: (C:) Diaminopimelate epimerase, chloroplastic

SCOPe Domain Sequences for d3ejxc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ejxc1 d.21.1.1 (C:25-158) Diaminopimelate epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gvlhfvkyhglgndfilvdnrdssepkitqeqaaklcdrnfgvgadgvifampgvngtdy
amrifnsdgsepemcgngvrcfarfiaelenlqgkhsftihtgaglivpeiqddgqvkvd
mgtpilkaqdvptk

SCOPe Domain Coordinates for d3ejxc1:

Click to download the PDB-style file with coordinates for d3ejxc1.
(The format of our PDB-style files is described here.)

Timeline for d3ejxc1: