Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily) mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix |
Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) duplication: consists of two similar domain swapped with C-terminal strands |
Family d.21.1.1: Diaminopimelate epimerase [54507] (2 proteins) automatically mapped to Pfam PF01678 |
Protein Diaminopimelate epimerase [54508] (3 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [267831] (2 PDB entries) |
Domain d3ejxb1: 3ejx B:25-158 [264751] Other proteins in same PDB: d3ejxb3 automated match to d4ijza1 complexed with zdp |
PDB Entry: 3ejx (more details), 1.95 Å
SCOPe Domain Sequences for d3ejxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ejxb1 d.21.1.1 (B:25-158) Diaminopimelate epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} gvlhfvkyhglgndfilvdnrdssepkitqeqaaklcdrnfgvgadgvifampgvngtdy amrifnsdgsepemcgngvrcfarfiaelenlqgkhsftihtgaglivpeiqddgqvkvd mgtpilkaqdvptk
Timeline for d3ejxb1: