SCOPe 2.06: Domain d1cowf2: 1cow F:9-81

Lineage for d1cowf2 (1cow F:9-81)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families)
   automatically mapped to Pfam PF02874

5. Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
   6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)

6. Protein F1 ATP synthase beta subunit, domain 1 [88677] (5 species)

7. Species Cow (Bos taurus) [TaxId:9913] [88678] (18 PDB entries)
   Uniprot P00829

8. Domain d1cowf2: 1cow F:9-81 [26475]
   Other proteins in same PDB: d1cowa1, d1cowa2, d1cowa3, d1cowb1, d1cowb2, d1cowb3, d1cowc1, d1cowc2, d1cowc3, d1cowd1, d1cowd3, d1cowe1, d1cowe3, d1cowf1, d1cowf3, d1cowg_
   complexed with adp, anp, aur, mg

Details for d1cowf2

PDB Entry: 1cow, 3.1 Å

PDB Description: bovine mitochondrial f1-atpase complexed with aurovertin b

PDB Compounds: (F:) bovine mitochondrial f1-ATPase

SCOPe Domain Sequences for d1cowf2:

Sequence; same for both SEQRES and ATOM records:

>d1cowf2 b.49.1.1 (F:9-81) F1 ATP synthase beta subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap

Timeline for d1cowf2:

• d1cowf2 first appeared (with stable ids) in SCOP 1.55
  
• d1cowf2 appears in SCOPe 2.05
  
• d1cowf2 appears in SCOPe 2.07
  
• d1cowf2 appears in the current release, SCOPe 2.08