Lineage for d3e8pd_ (3e8p D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944312Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2944313Protein automated matches [190143] (42 species)
    not a true protein
  7. 2944568Species Shewanella oneidensis [TaxId:70863] [267829] (1 PDB entry)
  8. 2944572Domain d3e8pd_: 3e8p D: [264746]
    automated match to d3e29b_

Details for d3e8pd_

PDB Entry: 3e8p (more details), 2.3 Å

PDB Description: crystal structure of the protein q8e9m7 from shewanella oneidensis related to thioesterase superfamily. northeast structural genomics consortium target sor246.
PDB Compounds: (D:) Uncharacterized protein

SCOPe Domain Sequences for d3e8pd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e8pd_ d.38.1.0 (D:) automated matches {Shewanella oneidensis [TaxId: 70863]}
snpiqaevlkrvaevfdqhvpfhnllgldikrydidgvevainmkpelignihqqilhgg
vtatvldvvggltafaglvasrddwtieelqqrlqtlgtidmrvdylrpgrgqiftgtgs
viragnrvsvcrmelhneqgthiafgtgtymvg

SCOPe Domain Coordinates for d3e8pd_:

Click to download the PDB-style file with coordinates for d3e8pd_.
(The format of our PDB-style files is described here.)

Timeline for d3e8pd_: