![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) ![]() |
![]() | Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
![]() | Protein automated matches [190143] (42 species) not a true protein |
![]() | Species Shewanella oneidensis [TaxId:70863] [267829] (1 PDB entry) |
![]() | Domain d3e8pa_: 3e8p A: [264743] automated match to d3e29b_ |
PDB Entry: 3e8p (more details), 2.3 Å
SCOPe Domain Sequences for d3e8pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e8pa_ d.38.1.0 (A:) automated matches {Shewanella oneidensis [TaxId: 70863]} snpiqaevlkrvaevfdqhvpfhnllgldikrydidgvevainmkpelignihqqilhgg vtatvldvvggltafaglvasrddwtieelqqrlqtlgtidmrvdylrpgrgqiftgtgs viragnrvsvcrmelhneqgthiafgtgtymvg
Timeline for d3e8pa_: