![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
![]() | Protein Laccase, C-terminal domain [418907] (5 species) |
![]() | Species Fungus (Melanocarpus albomyces) [TaxId:204285] [419309] (9 PDB entries) |
![]() | Domain d3dkhb3: 3dkh B:344-559 [264740] Other proteins in same PDB: d3dkha1, d3dkha2, d3dkhb1, d3dkhb2 automated match to d2q9oa3 complexed with cl, cu, gol, nag, oxy, so4; mutant has additional insertions and/or extensions that are not grouped together |
PDB Entry: 3dkh (more details), 2.4 Å
SCOPe Domain Sequences for d3dkhb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dkhb3 b.6.1.3 (B:344-559) Laccase, C-terminal domain {Fungus (Melanocarpus albomyces) [TaxId: 204285]} rsvpvnsfvkrpdntlpvaldltgtplfvwkvngsdinvdwgkpiidyiltgntsypvsd nivqvdavdqwtywliendpegpfslphpmhlhghdflvlgrspdvpaasqqrfvfdpav dlarlngdnpprrdttmlpaggwlllafrtdnpgawlfhchiawhvsgglsvdflerpad lrqrisqededdfnrvcdewraywptnpypkidsga
Timeline for d3dkhb3: