| Class b: All beta proteins [48724] (126 folds) |
| Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) ![]() |
| Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins) 6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?) |
| Protein F1 ATP synthase beta subunit, domain 1 [88677] (4 species) |
| Species Cow (Bos taurus) [TaxId:9913] [88678] (10 PDB entries) |
| Domain d1cowe2: 1cow E:9-81 [26474] Other proteins in same PDB: d1cowa1, d1cowa2, d1cowa3, d1cowb1, d1cowb2, d1cowb3, d1cowc1, d1cowc2, d1cowc3, d1cowd1, d1cowd3, d1cowe1, d1cowe3, d1cowf1, d1cowf3, d1cowg_ |
PDB Entry: 1cow (more details), 3.1 Å
SCOP Domain Sequences for d1cowe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cowe2 b.49.1.1 (E:9-81) F1 ATP synthase beta subunit, domain 1 {Cow (Bos taurus)}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap
Timeline for d1cowe2: