Lineage for d3dinh_ (3din H:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1956758Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 1956960Superfamily f.17.6: Sec-beta or SecG subunit of protein translocation channel [267595] (2 families) (S)
  5. 1956970Family f.17.6.2: SecG subunit [267613] (1 protein)
  6. 1956971Protein SecG [267651] (1 species)
  7. 1956972Species Thermotoga sp. [TaxId:126740] [267721] (1 PDB entry)
  8. 1956974Domain d3dinh_: 3din H: [264734]
    Other proteins in same PDB: d3dina1, d3dina2, d3dina3, d3dina4, d3dinb1, d3dinb2, d3dinb3, d3dinb4, d3dinc_, d3dind_, d3dinf_, d3ding_
    complexed with adp, bef, mg

Details for d3dinh_

PDB Entry: 3din (more details), 4.5 Å

PDB Description: crystal structure of the protein-translocation complex formed by the secy channel and the seca atpase
PDB Compounds: (H:) Preprotein translocase subunit secG

SCOPe Domain Sequences for d3dinh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dinh_ f.17.6.2 (H:) SecG {Thermotoga sp. [TaxId: 126740]}
htiisvaliymvqvqmskfselggafgsgglhtvfgrrkgldtggkitlvlsvlffvscv
vtafv

SCOPe Domain Coordinates for d3dinh_:

Click to download the PDB-style file with coordinates for d3dinh_.
(The format of our PDB-style files is described here.)

Timeline for d3dinh_: