SCOPe 2.07: Domain d3ding_: 3din G:

Lineage for d3ding_ (3din G:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.28: Preprotein translocase SecE subunit [103456] (1 family)

5. Family f.23.28.1: Preprotein translocase SecE subunit [103457] (1 protein)

6. Protein Preprotein translocase SecE subunit [103458] (3 species)

7. Species Thermotoga maritima MSB8 [TaxId:243274] [267720] (1 PDB entry)

8. Domain d3ding_: 3din G: [264733]
   Other proteins in same PDB: d3dina1, d3dina2, d3dina3, d3dina4, d3dinb1, d3dinb2, d3dinb3, d3dinb4, d3dinc_, d3dine_, d3dinf_, d3dinh_
   complexed with adp, bef, mg

Details for d3ding_

PDB Entry: 3din, 4.5 Å

PDB Description: crystal structure of the protein-translocation complex formed by the secy channel and the seca atpase

PDB Compounds: (G:) Preprotein translocase subunit secE

SCOPe Domain Sequences for d3ding_:

Sequence; same for both SEQRES and ATOM records:

>d3ding_ f.23.28.1 (G:) Preprotein translocase SecE subunit {Thermotoga maritima MSB8 [TaxId: 243274]}
eviaeakkiswpsrkelltsfgvvlvilavtsvyffvldfifsgvvsaifkalgig

Timeline for d3ding_:

• d3ding_ first appeared in SCOPe 2.05
  
• d3ding_ appears in SCOPe 2.06
  
• d3ding_ appears in the current release, SCOPe 2.08