Lineage for d3dinf_ (3din F:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2580573Fold f.41: Preprotein translocase SecY subunit [103490] (1 superfamily)
    10 transmembrane helices forming of a gated channel
  4. 2580574Superfamily f.41.1: Preprotein translocase SecY subunit [103491] (2 families) (S)
    duplication: consists of two similar structural parts
  5. 2580575Family f.41.1.1: Preprotein translocase SecY subunit [103492] (1 protein)
    automatically mapped to Pfam PF00344
  6. 2580576Protein Preprotein translocase SecY subunit [103493] (2 species)
  7. 2580580Species Thermotoga maritima MSB8 [TaxId:243274] [267719] (1 PDB entry)
  8. 2580582Domain d3dinf_: 3din F: [264732]
    Other proteins in same PDB: d3dina1, d3dina2, d3dina3, d3dina4, d3dinb1, d3dinb2, d3dinb3, d3dinb4, d3dind_, d3dine_, d3ding_, d3dinh_
    complexed with adp, bef, mg

Details for d3dinf_

PDB Entry: 3din (more details), 4.5 Å

PDB Description: crystal structure of the protein-translocation complex formed by the secy channel and the seca atpase
PDB Compounds: (F:) Preprotein translocase subunit secY

SCOPe Domain Sequences for d3dinf_:

Sequence, based on SEQRES records: (download)

>d3dinf_ f.41.1.1 (F:) Preprotein translocase SecY subunit {Thermotoga maritima MSB8 [TaxId: 243274]}
afkipelrdriiftflalivfrmgiyipvpglnleawgeifrriaetagvagilsfydvf
tggalsrfsvftmsvtpyitasiilqllasvmpslkemlregeegrkkfakytrrltlli
ggfqaffvsfslarsnpdmvapgvnvlqftvlstmsmlagtmfllwlgeritekgigngi
silifagivarypsyirqaylgglnllewifliavalitifgiilvqqaerritiqyarr
vtgrrvyggastylpikvnqggvipiifasaivsipsaiasitnnetlknlfraggflyl
liygllvffftyfysvvifdpreisenirkyggyipglrpgrsteqylhrvlnrvtfiga
vflvviallpylvqgaikvnvwiggtsaliavgvaldiiqqmethmvmrhyegfik

Sequence, based on observed residues (ATOM records): (download)

>d3dinf_ f.41.1.1 (F:) Preprotein translocase SecY subunit {Thermotoga maritima MSB8 [TaxId: 243274]}
afkipelrdriiftflalivfrmgiyipvpglnlsfydvftggalsrfsvftmsvtpyit
asiilqllasvmpslkemlregeegrkkfakytrrltlliggfqaffvsfslarsnpdmv
apgvnvlqftvlstmsmlagtmfllwlgeritekgigngisilifagivarypsyirqay
lgglnllewifliavalitifgiilvqqaerritiqyarrvtgrrvyggastylpikvnq
ggvipiifasaivsipsaiasitnnetlknlfraggflylliygllvffftyfysvvifd
preisenirkyggyipglrpgrsteqylhrvlnrvtfigavflvviallpylvqgaikvn
vwiggtsaliavgvaldiiqqmethmvmrhyegfik

SCOPe Domain Coordinates for d3dinf_:

Click to download the PDB-style file with coordinates for d3dinf_.
(The format of our PDB-style files is described here.)

Timeline for d3dinf_: