Lineage for d3dind_ (3din D:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631705Superfamily f.23.28: Preprotein translocase SecE subunit [103456] (1 family) (S)
  5. 2631706Family f.23.28.1: Preprotein translocase SecE subunit [103457] (1 protein)
  6. 2631707Protein Preprotein translocase SecE subunit [103458] (3 species)
  7. 2631715Species Thermotoga maritima MSB8 [TaxId:243274] [267720] (1 PDB entry)
  8. 2631716Domain d3dind_: 3din D: [264730]
    Other proteins in same PDB: d3dina1, d3dina2, d3dina3, d3dina4, d3dinb1, d3dinb2, d3dinb3, d3dinb4, d3dinc_, d3dine_, d3dinf_, d3dinh_
    complexed with adp, bef, mg

Details for d3dind_

PDB Entry: 3din (more details), 4.5 Å

PDB Description: crystal structure of the protein-translocation complex formed by the secy channel and the seca atpase
PDB Compounds: (D:) Preprotein translocase subunit secE

SCOPe Domain Sequences for d3dind_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dind_ f.23.28.1 (D:) Preprotein translocase SecE subunit {Thermotoga maritima MSB8 [TaxId: 243274]}
eviaeakkiswpsrkelltsfgvvlvilavtsvyffvldfifsgvvsaifkalgig

SCOPe Domain Coordinates for d3dind_:

Click to download the PDB-style file with coordinates for d3dind_.
(The format of our PDB-style files is described here.)

Timeline for d3dind_: