Lineage for d1cowd2 (1cow D:9-81)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 15612Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)
  4. 15613Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
  5. 15614Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (1 protein)
  6. 15615Protein N-terminal domain of alpha and beta subunits of F1 ATP synthase [50617] (3 species)
  7. 15619Species Cow (Bos taurus) [TaxId:9913] [50618] (7 PDB entries)
  8. 15659Domain d1cowd2: 1cow D:9-81 [26473]
    Other proteins in same PDB: d1cowa1, d1cowa3, d1cowb1, d1cowb3, d1cowc1, d1cowc3, d1cowd1, d1cowd3, d1cowe1, d1cowe3, d1cowf1, d1cowf3, d1cowg_

Details for d1cowd2

PDB Entry: 1cow (more details), 3.1 Å

PDB Description: bovine mitochondrial f1-atpase complexed with aurovertin b

SCOP Domain Sequences for d1cowd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cowd2 b.49.1.1 (D:9-81) N-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap

SCOP Domain Coordinates for d1cowd2:

Click to download the PDB-style file with coordinates for d1cowd2.
(The format of our PDB-style files is described here.)

Timeline for d1cowd2: