Lineage for d3dinc_ (3din C:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1959477Fold f.41: Preprotein translocase SecY subunit [103490] (1 superfamily)
    10 transmembrane helices forming of a gated channel
  4. 1959478Superfamily f.41.1: Preprotein translocase SecY subunit [103491] (2 families) (S)
    duplication: consists of two similar structural parts
  5. 1959479Family f.41.1.1: Preprotein translocase SecY subunit [103492] (1 protein)
    automatically mapped to Pfam PF00344
  6. 1959480Protein Preprotein translocase SecY subunit [103493] (2 species)
  7. 1959484Species Thermotoga maritima MSB8 [TaxId:243274] [267719] (1 PDB entry)
  8. 1959485Domain d3dinc_: 3din C: [264729]
    Other proteins in same PDB: d3dina1, d3dina2, d3dina3, d3dina4, d3dinb1, d3dinb2, d3dinb3, d3dinb4, d3dind_, d3dine_, d3ding_, d3dinh_
    complexed with adp, bef, mg

Details for d3dinc_

PDB Entry: 3din (more details), 4.5 Å

PDB Description: crystal structure of the protein-translocation complex formed by the secy channel and the seca atpase
PDB Compounds: (C:) Preprotein translocase subunit secY

SCOPe Domain Sequences for d3dinc_:

Sequence, based on SEQRES records: (download)

>d3dinc_ f.41.1.1 (C:) Preprotein translocase SecY subunit {Thermotoga maritima MSB8 [TaxId: 243274]}
afkipelrdriiftflalivfrmgiyipvpglnleawgeifrriaetagvagilsfydvf
tggalsrfsvftmsvtpyitasiilqllasvmpslkemlregeegrkkfakytrrltlli
ggfqaffvsfslarsnpdmvapgvnvlqftvlstmsmlagtmfllwlgeritekgigngi
silifagivarypsyirqaylgglnllewifliavalitifgiilvqqaerritiqyarr
vtgrrvyggastylpikvnqggvipiifasaivsipsaiasitnnetlknlfraggflyl
liygllvffftyfysvvifdpreisenirkyggyipglrpgrsteqylhrvlnrvtfiga
vflvviallpylvqgaikvnvwiggtsaliavgvaldiiqqmethmvmrhyegfik

Sequence, based on observed residues (ATOM records): (download)

>d3dinc_ f.41.1.1 (C:) Preprotein translocase SecY subunit {Thermotoga maritima MSB8 [TaxId: 243274]}
afkipelrdriiftflalivfrmgiyipvpglnlsfydvftggalsrfsvftmsvtpyit
asiilqllasvmpslkemlregeegrkkfakytrrltlliggfqaffvsfslarsnpdmv
apgvnvlqftvlstmsmlagtmfllwlgeritekgigngisilifagivarypsyirqay
lgglnllewifliavalitifgiilvqqaerritiqyarrvtgrrvyggastylpikvnq
ggvipiifasaivsipsaiasitnnetlknlfraggflylliygllvffftyfysvvifd
preisenirkyggyipglrpgrsteqylhrvlnrvtfigavflvviallpylvqgaikvn
vwiggtsaliavgvaldiiqqmethmvmrhyegfik

SCOPe Domain Coordinates for d3dinc_:

Click to download the PDB-style file with coordinates for d3dinc_.
(The format of our PDB-style files is described here.)

Timeline for d3dinc_: