SCOPe 2.07: Domain d3dinb4: 3din B:1-270,B:393-440

Lineage for d3dinb4 (3din B:1-270,B:393-440)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (27 proteins)
   duplication: tandem repeat of two RecA-like (AAA) domains

6. Protein Translocation ATPase SecA, nucleotide-binding domains [82414] (3 species)
   a pre-protein crosslinking domain inserted in the first AAA domain

7. Species Thermotoga maritima MSB8 [TaxId:243274] [267718] (1 PDB entry)

8. Domain d3dinb4: 3din B:1-270,B:393-440 [264728]
   Other proteins in same PDB: d3dina1, d3dina2, d3dinb1, d3dinb2, d3dinc_, d3dind_, d3dine_, d3dinf_, d3ding_, d3dinh_
   complexed with adp, bef, mg

Details for d3dinb4

PDB Entry: 3din, 4.5 Å

PDB Description: crystal structure of the protein-translocation complex formed by the secy channel and the seca atpase

PDB Compounds: (B:) Protein translocase subunit secA

SCOPe Domain Sequences for d3dinb4:

Sequence; same for both SEQRES and ATOM records:

>d3dinb4 c.37.1.19 (B:1-270,B:393-440) Translocation ATPase SecA, nucleotide-binding domains {Thermotoga maritima MSB8 [TaxId: 243274]}
milfdknkrilkkyakmvskinqiesdlrskknselirlsmvlkekvnsfedadehlfea
falvreaarrtlgmrpfdvqvmggialhegkvaemktgegktlaatmpiylnaligkgvh
lvtvndylarrdalwmgpvylflglrvgvinslgksyevvwknpdlarkaieenwsvwpd
gfngevlkeesmnkeaveafqvelkeitrkeaylcdvtygtnnefgfdylrdnlvldynd
kvqrghfyaivdeadsvlideartpliisgXesityatitfqnyfrmyeklagmtgtakt
eesefvqvygmevvvipth

Timeline for d3dinb4:

• d3dinb4 first appeared in SCOPe 2.05
  
• d3dinb4 appears in SCOPe 2.06
  
• d3dinb4 appears in the current release, SCOPe 2.08