| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.19: Tandem AAA-ATPase domain [81268] (27 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
| Protein Translocation ATPase SecA, nucleotide-binding domains [82414] (3 species) a pre-protein crosslinking domain inserted in the first AAA domain |
| Species Thermotoga maritima MSB8 [TaxId:243274] [267718] (1 PDB entry) |
| Domain d3dinb3: 3din B:441-618 [264727] Other proteins in same PDB: d3dina1, d3dina2, d3dinb1, d3dinb2, d3dinc_, d3dind_, d3dine_, d3dinf_, d3ding_, d3dinh_ complexed with adp, bef, mg |
PDB Entry: 3din (more details), 4.5 Å
SCOPe Domain Sequences for d3dinb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dinb3 c.37.1.19 (B:441-618) Translocation ATPase SecA, nucleotide-binding domains {Thermotoga maritima MSB8 [TaxId: 243274]}
kpmirkdhddlvfrtqkekyekiveeiekrykkgqpvlvgttsieksellssmlkkkgip
hqvlnakyhekeaeivakagqkgmvtiatnmagrgtdiklgpgvaelgglciigterhes
rridnqlrgragrqgdpgesifflsleddllrifgseqigkvmnilkieegqpiqhpm
Timeline for d3dinb3: