![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.162: Pre-protein crosslinking domain of SecA [81766] (1 superfamily) core: 4 helices: bundle; flanked by two short beta-hairpins duplication: consists of two structural repeats |
![]() | Superfamily a.162.1: Pre-protein crosslinking domain of SecA [81767] (1 family) ![]() automatically mapped to Pfam PF01043 |
![]() | Family a.162.1.1: Pre-protein crosslinking domain of SecA [81768] (1 protein) |
![]() | Protein Pre-protein crosslinking domain of SecA [81769] (3 species) |
![]() | Species Thermotoga maritima MSB8 [TaxId:243274] [267716] (1 PDB entry) |
![]() | Domain d3dinb1: 3din B:271-392 [264725] Other proteins in same PDB: d3dina2, d3dina3, d3dina4, d3dinb2, d3dinb3, d3dinb4, d3dinc_, d3dind_, d3dine_, d3dinf_, d3ding_, d3dinh_ complexed with adp, bef, mg |
PDB Entry: 3din (more details), 4.5 Å
SCOPe Domain Sequences for d3dinb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dinb1 a.162.1.1 (B:271-392) Pre-protein crosslinking domain of SecA {Thermotoga maritima MSB8 [TaxId: 243274]} pskespsvyrrfaqiakkfvkdkdftvdekartiilteegvakaekiigvenlydpgnvs llyhlinalkalhlfkkdvdyvvmngeviivdeftgrllpgrrysgglhqaieakegvpi ke
Timeline for d3dinb1: