Lineage for d3dina4 (3din A:1-270,A:393-440)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870646Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2870913Protein Translocation ATPase SecA, nucleotide-binding domains, N-terminal domain [418978] (3 species)
    a pre-protein crosslinking domain inserted in this first AAA domain
  7. 2870924Species Thermotoga maritima MSB8 [TaxId:243274] [419446] (1 PDB entry)
  8. 2870925Domain d3dina4: 3din A:1-270,A:393-440 [264724]
    Other proteins in same PDB: d3dina1, d3dina2, d3dina3, d3dinb1, d3dinb2, d3dinb3, d3dinc_, d3dind_, d3dine_, d3dinf_, d3ding_, d3dinh_
    complexed with adp, bef, mg
    has additional insertions and/or extensions that are not grouped together

Details for d3dina4

PDB Entry: 3din (more details), 4.5 Å

PDB Description: crystal structure of the protein-translocation complex formed by the secy channel and the seca atpase
PDB Compounds: (A:) Protein translocase subunit secA

SCOPe Domain Sequences for d3dina4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dina4 c.37.1.19 (A:1-270,A:393-440) Translocation ATPase SecA, nucleotide-binding domains, N-terminal domain {Thermotoga maritima MSB8 [TaxId: 243274]}
milfdknkrilkkyakmvskinqiesdlrskknselirlsmvlkekvnsfedadehlfea
falvreaarrtlgmrpfdvqvmggialhegkvaemktgegktlaatmpiylnaligkgvh
lvtvndylarrdalwmgpvylflglrvgvinslgksyevvwknpdlarkaieenwsvwpd
gfngevlkeesmnkeaveafqvelkeitrkeaylcdvtygtnnefgfdylrdnlvldynd
kvqrghfyaivdeadsvlideartpliisgXesityatitfqnyfrmyeklagmtgtakt
eesefvqvygmevvvipth

SCOPe Domain Coordinates for d3dina4:

Click to download the PDB-style file with coordinates for d3dina4.
(The format of our PDB-style files is described here.)

Timeline for d3dina4: